Structure of PDB 7t6i Chain B Binding Site BS01

Receptor Information
>7t6i Chain B (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATPENYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTEL
GRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSP
SHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVM
LEMTPQQGDVYICQVEHTSLDSPVTVEWKATG
Ligand information
>7t6i Chain C (length=16) Species: 10360 (Human herpesvirus 5 strain AD169) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PVADAVIHASGKQMWQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t6i Human T cells recognize HLA-DP-bound peptides in two orientations.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q13 Y28 A55 W59 E68 K69 H79 N80 L83 D84
Binding residue
(residue number reindexed from 1)		Q12 Y27 A54 W58 E67 K68 H78 N79 L82 D83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t6i, PDBe:7t6i, PDBj:7t6i
PDBsum7t6i
PubMed36442096
UniProtS6B6U4

[Back to BioLiP]