Structure of PDB 7t6a Chain B Binding Site BS01

Receptor Information
>7t6a Chain B (length=185) Species: 59765 (Fusarium oxysporum f. sp. lycopersici) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAHTESVCVHAGTATGADLHWLNAICTGKSTYTVNCAPAGNKNAGSTHTG
TCPAGQDCFQLEQVGNFWGDREPDATCSPSNTVFDAVDDKEATHVNGKVV
TRAGKPGIGRKLIRLKAQVYRRDGHYGQTSRMGFFRNGKEVYHIDNVASM
EPTWNFDPSSDQSFSFFFTPGPNAFRIQGTLNLAS
Ligand information
>7t6a Chain D (length=21) Species: 59765 (Fusarium oxysporum f. sp. lycopersici) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EGDIIGTFNFSDSQPLKIHWV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t6a MX2: a high-flux undulator microfocus beamline serving both the chemical and macromolecular crystallography communities at the Australian Synchrotron.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		N139 V141 F142 R160 A161 G162 K163 G165 L239 N240
Binding residue
(residue number reindexed from 1)		N81 V83 F84 R102 A103 G104 K105 G107 L181 N182
Enzymatic activity
Enzyme Commision number ?
External links