Structure of PDB 7t1u Chain B Binding Site BS01

Receptor Information
>7t1u Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGAPWQAEEWYFGKITRRESERLLLNAENPRGTFLVREGQSQPDYVLSVS
DFDNAKGLNVKHYIIRKLDSGFYITSRTQFNSLQQLVAYYSKHADGLCHR
LTTVCPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t1u Engineered SH2 Domains for Targeted Phosphoproteomics.
Resolution2.65 Å
Binding residue
(original residue number in PDB)
R158 R178 G180 S182 Q183 K202 H203 Y204 I205 I216 G238
Binding residue
(residue number reindexed from 1)
R17 R37 G39 S41 Q42 K61 H62 Y63 I64 I74 G96
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:7t1u, PDBe:7t1u, PDBj:7t1u
PDBsum7t1u
PubMed35613471
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]