Structure of PDB 7snv Chain B Binding Site BS01

Receptor Information
>7snv Chain B (length=107) Species: 555778 (Halothiobacillus neapolitanus c2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQDYKQSLKYETFSYLPPMNAERIRAQIKYAIAQGWSPGIEHVEVKNSMN
QYWYMWKLPFFGEQNVDNVLAEIEACRSAYPTHQVKLVAYDNYAQSLGLA
FVVYRGN
Ligand information
>7snv Chain C (length=9) Species: 555778 (Halothiobacillus neapolitanus c2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PRLDLIEQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7snv Discovery of a carbonic anhydrase-rubisco supercomplex within the alpha-carboxysome
Resolution2.07 Å
Binding residue
(original residue number in PDB)		Y96 A97
Binding residue
(residue number reindexed from 1)		Y93 A94
Enzymatic activity
Enzyme Commision number 4.1.1.39: ribulose-bisphosphate carboxylase.
Gene Ontology
Molecular Function
GO:0016984 ribulose-bisphosphate carboxylase activity
Biological Process
GO:0015977 carbon fixation
GO:0019253 reductive pentose-phosphate cycle
Cellular Component
GO:0031470 carboxysome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7snv, PDBe:7snv, PDBj:7snv
PDBsum7snv
PubMed37862384
UniProtP45686|RBS_HALNC Ribulose bisphosphate carboxylase small subunit (Gene Name=cbbS)

[Back to BioLiP]