Structure of PDB 7sn6 Chain B Binding Site BS01

Receptor Information
>7sn6 Chain B (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYH
RRDFW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sn6 A UHM-ULM interface with unusual structural features contributes to U2AF2 and SF3B1 association for pre-mRNA splicing.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		M383 E394 E397 D401 E405 K408 R452 K453 F454 A455
Binding residue
(residue number reindexed from 1)		M13 E24 E27 D31 E35 K38 R82 K83 F84 A85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7sn6, PDBe:7sn6, PDBj:7sn6
PDBsum7sn6
PubMed35780835
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]