BioLiP

Receptor Information

>7slq Chain B (length=321) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFN
KMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVY
VELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQ
AAKAIEFLLRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESTGPQ
FVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHARFKTP
EDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAKLNQPREK
KRGTEKLITKAEKIRLAKTQQ

>7slq Chain R (length=51) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggaugugcacauccaaaugaggcgcugcauguggcagucugccuuucuuu
u

<<<<<<<>>>>>>>......<<<<<<<<.....>>>>>..>>>.......
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7slq Structural basis of RNA conformational switching in the transcriptional regulator 7SK RNP.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	F44 D54 F56 L57 F77 N78 K79 H138 S155 P157 H158 K160 F168 F170 K381 W384 K388 L392 Q395 K396 M399 R468 L482 Y483 V484 D485 R496 Y532 I536 D539 R540 K543 L544 R548 K550 R552 G553 T554
Binding residue (residue number reindexed from 1)	F16 D26 F28 L29 F49 N50 K51 H110 S127 P129 H130 K132 F140 F142 K164 W167 K171 L175 Q178 K179 M182 R218 L232 Y233 V234 D235 R246 Y282 I286 D289 R290 K293 L294 R298 K300 R302 G303 T304

Enzyme Commision number

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0006396	RNA processing

	Cellular Component
GO:0005634	nucleus
GO:1990904	ribonucleoprotein complex

PDB	RCSB:7slq, PDBe:7slq, PDBj:7slq
PDBsum	7slq
PubMed	35320752
UniProt	Q4G0J3\|LARP7_HUMAN La-related protein 7 (Gene Name=LARP7)

[Back to BioLiP]

Structure of PDB 7slq Chain B Binding Site BS01