Structure of PDB 7sg1 Chain B Binding Site BS01

Receptor Information
>7sg1 Chain B (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVML
EMRGDVYTCHVEHPSLQSPITVEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sg1 Structural basis of T cell receptor specificity and cross-reactivity of two HLA-DQ2.5-restricted gluten epitopes in celiac disease.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
Y9 F11 G13 L26 P56 A57 Y60 W61 R77 V78 N82
Binding residue
(residue number reindexed from 1)
Y7 F9 G11 L24 P54 A55 Y58 W59 R75 V76 N80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7sg1, PDBe:7sg1, PDBj:7sg1
PDBsum7sg1
PubMed35065967
UniProtQ5Y7D3

[Back to BioLiP]