Structure of PDB 7sg0 Chain B Binding Site BS01

Receptor Information
>7sg0 Chain B (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVM
LEMTPVYTCHVEHPSLQSPITVEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sg0 W316 TCR in complex with HLA-DQ2-omega1
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y9 F11 G13 L26 A57 W61 I67 R70 H81 N82 L85
Binding residue
(residue number reindexed from 1)		Y7 F9 G11 L24 A55 W59 I65 R68 H79 N80 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sg0, PDBe:7sg0, PDBj:7sg0
PDBsum7sg0
PubMed35065967
UniProtO19712

[Back to BioLiP]