Structure of PDB 7s5h Chain B Binding Site BS01

Receptor Information

>7s5h Chain B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VEVYLLDTSIQSDHREIEGRVMVTDFENVPEETRFHRQASKCDSHGTHLA
GVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVGPLV
VLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVI
TVGATNAQDQPVGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAA
AHVAGIAAMMLSAEPELTLAELRQRLIHFS

Ligand information

>7s5h Chain C (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cCAAFWPTYPC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s5h A Series of Novel, Highly Potent, and Orally Bioavailable Next-Generation Tricyclic Peptide PCSK9 Inhibitors.
Resolution	1.272 Å
Binding residue (original residue number in PDB)	D238 D367 I369 D374 T377 C378 F379 V380 S381
Binding residue (residue number reindexed from 1)	D57 D178 I180 D185 T188 C189 F190 V191 S192

Enzymatic activity

Enzyme Commision number

3.4.21.-

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7s5h, PDBe:7s5h, PDBj:7s5h
PDBsum	7s5h
PubMed	34704436
UniProt	Q8NBP7\|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 (Gene Name=PCSK9)

[Back to BioLiP]