Structure of PDB 7s4q Chain B Binding Site BS01

Receptor Information

>7s4q Chain B (length=277) Species: 34 (Myxococcus xanthus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PDFLGHAENPLREEEWARLNETVIQVARRSLVGRRILDIYGPLGAGVQTV
PYDEFQGVSPGAVDIVGEQETAMVFTDARKFKTIPIIYKDFLLHWRDIEA
ARTHNMPLDVSAAAGAAALCAQQEDELIFYGDARLGYEGLMTANGRLTVP
LGDWTSPGGGFQAIVEATRKLNEQGHFGPYAVVLSPRLYSQLHRIYEKTG
VLEIETIRQLASDGVYQSNRLRGESGVVVSTGRENMDLAVSMDMVAAYLG
ASRMNHPFRVLEALLLRIKHPDAICTL

Ligand information

>7s4q Chain G (length=12) Species: 34 (Myxococcus xanthus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PEKRLTVGSLRR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7s4q Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	R28 R34 R35 I36 L37 I39 P42 L43 D213 D243
Binding residue (residue number reindexed from 1)	R28 R34 R35 I36 L37 I39 P42 L43 D213 D243

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006826	iron ion transport
GO:0006879	intracellular iron ion homeostasis

	Cellular Component
GO:0140737	encapsulin nanocompartment

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7s4q, PDBe:7s4q, PDBj:7s4q
PDBsum	7s4q
PubMed	35150605
UniProt	Q1D6H4\|ENCAP_MYXXD Type 1 encapsulin shell protein EncA (Gene Name=encA)

[Back to BioLiP]