Structure of PDB 7s4o Chain B Binding Site BS01

Receptor Information
>7s4o Chain B (length=162) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAQQLPVIGGIAIPELGINLPIFKGLGNTELIYGAGTMKEEQVMGGENNY
SLASHHIFGITGSSQMLFSPLERAQNGMSIYLTDKEKIYEYIIKDVFTVA
PERVDVIDDTAGLKEVTLVTATDIEATERIIVKGELKTEYDFDKAPADVL
KAFNHSYNQVST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s4o Structures of Streptococcus pyogenes class A sortase in complex with substrate and product mimics provide key details of target recognition.
Resolution1.396 Å
Binding residue
(original residue number in PDB)		M125 S141 H142 H143 P188 T207 A208 I211 R216
Binding residue
(residue number reindexed from 1)		M38 S54 H55 H56 P101 T120 A121 I124 R129
Enzymatic activity
Enzyme Commision number ?
External links