Structure of PDB 7rpu Chain B Binding Site BS01

Receptor Information
>7rpu Chain B (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQTPLSSAVTLGQPASISCRSSQRLVHSDGNTYLSWLHQRPGQPPR
LLIYKVSLRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGIYYCMQATQFP
LTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGE
Ligand information
>7rpu Chain P (length=13) Species: 129000 (Ebola virus - Eckron (Zaire, 1976)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IHDFVDKTLPDQG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rpu Protection against Ebola virus disease and neutralization mechanism of a survivor's anti-stalk-MPER antibody
Resolution1.27 Å
Binding residue
(original residue number in PDB)		H31 S32 Y37 Y54 F60 A96 T97 Q98 F99
Binding residue
(residue number reindexed from 1)		H31 S32 Y37 Y54 F60 A96 T97 Q98 F99
External links