Structure of PDB 7rlz Chain B Binding Site BS01

Receptor Information
>7rlz Chain B (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQTPLSLSVTIGQPASISCKSSQSLLHSNGKTYLNWLQQRPGQAPK
ILMYLVSKLDPGIPDRFSGSGSETDFTLKISRVEAEDLGVYYCLQGTYYP
FTFGSGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rlz Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
Resolution2.27 Å
Binding residue
(original residue number in PDB)		H27D Y32 N34 G91 Y93 Y94 F96
Binding residue
(residue number reindexed from 1)		H31 Y37 N39 G96 Y98 Y99 F101
External links