Structure of PDB 7rjn Chain B Binding Site BS01

Receptor Information
>7rjn Chain B (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPD
YHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDI
VLMAQALEKIFLQKVAQMPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rjn Uncovering the Bromodomain Interactome using Site-Specific Azide-Acetyllysine Photochemistry, Proteomic Profiling and Structural Characterization
Resolution1.95 Å
Binding residue
(original residue number in PDB)		W57 V63 L70 N116 D120 D121 I122
Binding residue
(residue number reindexed from 1)		W35 V41 L48 N94 D98 D99 I100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7rjn, PDBe:7rjn, PDBj:7rjn
PDBsum7rjn
PubMed
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]