Structure of PDB 7qu8 Chain B Binding Site BS01

Receptor Information
>7qu8 Chain B (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYEAH
LMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKP
PDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVL
NNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGD
WSSEGCSTEVRPEGTVCCCDHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qu8 GPR97-mediated PAR2 transactivation via a mPR3-associated macromolecular complex induces inflammatory activation of human neutrophils
Resolution3.37 Å
Binding residue
(original residue number in PDB)
L72 E75 F163 G173 S174 G175 L177 L181 V182 G183 L184 I200 F202 H204 N210 M211 T212 L213 T214 C215 V216 F217 W218 W228 T242
Binding residue
(residue number reindexed from 1)
L45 E48 F136 G146 S147 G148 L150 L154 V155 G156 L157 I173 F175 H177 N183 M184 T185 L186 T187 C188 V189 F190 W191 W201 T215
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qu8, PDBe:7qu8, PDBj:7qu8
PDBsum7qu8
PubMed
UniProtQ86Y34|AGRG3_HUMAN Adhesion G protein-coupled receptor G3 (Gene Name=ADGRG3)

[Back to BioLiP]