Structure of PDB 7qto Chain B Binding Site BS01

Receptor Information
>7qto Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLIPARIEEELTLTILRGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPA
ARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGGTAVQMRVWRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qto Structural Basis of the Avian Influenza NS1 Protein Interactions with the Cell Polarity Regulator Scribble.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
I742 A743 S748 S761 V797 R801
Binding residue
(residue number reindexed from 1)
I23 A24 S29 S42 V78 R82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qto, PDBe:7qto, PDBj:7qto
PDBsum7qto
PubMed35336989
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]