Structure of PDB 7qs9 Chain B Binding Site BS01

Receptor Information
>7qs9 Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEEELTLTILRQGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGV
RVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRE
Ligand information
>7qs9 Chain E (length=5) Species: 11084 (Tick-borne encephalitis virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YSTAV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qs9 Molecular basis of Tick Born encephalitis virus NS5 mediated subversion of apico-basal cell polarity signalling.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		G737 L738 I740 S741 I742 A743 S748 S761 H793 V797
Binding residue
(residue number reindexed from 1)		G13 L14 I16 S17 I18 A19 S24 S37 H69 V73
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qs9, PDBe:7qs9, PDBj:7qs9
PDBsum7qs9
PubMed35670457
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]