Structure of PDB 7qrt Chain B Binding Site BS01

Receptor Information
>7qrt Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGT
LQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLERE
Ligand information
>7qrt Chain C (length=8) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KHFRETEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qrt Structural insight into the Scribble PDZ domains interaction with the oncogenic Human T-cell lymphotrophic virus-1 (HTLV-1) Tax1 PBM.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		G23 L24 G25 F26 S27 I28 A29 S34 T35 S47 H80
Binding residue
(residue number reindexed from 1)		G13 L14 G15 F16 S17 I18 A19 S24 T25 S37 H70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qrt, PDBe:7qrt, PDBj:7qrt
PDBsum7qrt
PubMed36029163
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]