Structure of PDB 7qrs Chain B Binding Site BS01

Receptor Information
>7qrs Chain B (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
PAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERM
Ligand information
>7qrs Chain C (length=8) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KHFRETEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qrs Structural insight into the Scribble PDZ domains interaction with the oncogenic Human T-cell lymphotrophic virus-1 (HTLV-1) Tax1 PBM.
Resolution1.77 Å
Binding residue
(original residue number in PDB)		G737 L738 I740 S741 I742 A743 S748 T749 S761 R762 H793 V797
Binding residue
(residue number reindexed from 1)		G20 L21 I23 S24 I25 A26 S31 T32 S44 R45 H76 V80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qrs, PDBe:7qrs, PDBj:7qrs
PDBsum7qrs
PubMed36029163
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]