Structure of PDB 7qqd Chain B Binding Site BS01

Receptor Information
>7qqd Chain B (length=162) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLG
EKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKG
KIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLC
VQPHHIGVTIKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qqd Nuclear factor one X - NFIX in P41212
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Q122 A123
Binding residue
(residue number reindexed from 1)		Q110 A111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qqd, PDBe:7qqd, PDBj:7qqd
PDBsum7qqd
PubMed
UniProtQ14938|NFIX_HUMAN Nuclear factor 1 X-type (Gene Name=NFIX)

[Back to BioLiP]