Structure of PDB 7qhp Chain B Binding Site BS01

Receptor Information

>7qhp Chain B (length=184) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELG
RHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSR
TEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTF
QVLVMLEMTPHQEVYTCHVEHPSLKSPITVEWRA

Ligand information

>7qhp Chain T (length=13) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LQTLALEVEDDPC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7qhp Structural plasticity in I-A g7 links autoreactivity to hybrid insulin peptides in type I diabetes.
Resolution	1.82 Å
Binding residue (original residue number in PDB)	F11 G13 L26 Y30 Y60 Y61 Y65 R68 E72 H79 N80 E83 T84
Binding residue (residue number reindexed from 1)	F7 G9 L22 Y26 Y56 Y57 Y61 R64 E68 H75 N76 E79 T80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qhp, PDBe:7qhp, PDBj:7qhp
PDBsum	7qhp
PubMed	35967292
UniProt	Q31135

[Back to BioLiP]