Structure of PDB 7qde Chain B Binding Site BS01

Receptor Information
>7qde Chain B (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFV
EFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKRYRITMKNLPEGCSW
QDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEEILVEALERLNNIEF
RGSVITVERDDNPPPIRRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qde NMR structure of Npl3 RRM12 bound to the AUCCAGUGGAA RNA
ResolutionN/A
Binding residue
(original residue number in PDB)		M114 R126 F128 R130 K155 L157 F160 F162 Y192 S193 K194 L195 P196 R199 S212 W213 Q214 D215 K217 D218 F229 S230 E244 P278 I279 S282
Binding residue
(residue number reindexed from 1)		M1 R13 F15 R17 K42 L44 F47 F49 Y79 S80 K81 L82 P83 R86 S99 W100 Q101 D102 K104 D105 F116 S117 E131 P165 I166 S169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7qde, PDBe:7qde, PDBj:7qde
PDBsum7qde
PubMed37935663
UniProtQ01560|NOP3_YEAST Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 (Gene Name=NPL3)

[Back to BioLiP]