Structure of PDB 7qdd Chain B Binding Site BS01

Receptor Information
>7qdd Chain B (length=88) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFV
EFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKRYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qdd The structure of yeast Npl3 bound to RNA reveals a cooperative sequence-specific recognition and an RNA chaperone role in splicing
ResolutionN/A
Binding residue
(original residue number in PDB)		R126 F128 R130 P131 L157 F160 F162 S193 K194 L195 P196 A197 K198 R199
Binding residue
(residue number reindexed from 1)		R13 F15 R17 P18 L44 F47 F49 S80 K81 L82 P83 A84 K85 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7qdd, PDBe:7qdd, PDBj:7qdd
PDBsum7qdd
PubMed37935663
UniProtQ01560|NOP3_YEAST Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 (Gene Name=NPL3)

[Back to BioLiP]