Structure of PDB 7qcs Chain B Binding Site BS01

Receptor Information
>7qcs Chain B (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGG
AAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS
Ligand information
>7qcs Chain D (length=5) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PDLLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qcs Interactions of Severe Acute Respiratory Syndrome Coronavirus 2 Protein E With Cell Junctions and Polarity PSD-95/Dlg/ZO-1-Containing Proteins.
Resolution2.804 Å
Binding residue
(original residue number in PDB)		P30 L31 G32 A33 T34 V35 S45 L85
Binding residue
(residue number reindexed from 1)		P29 L30 G31 A32 T33 V34 S44 L84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qcs, PDBe:7qcs, PDBj:7qcs
PDBsum7qcs
PubMed35283834
UniProtQ8N3R9|PALS1_HUMAN Protein PALS1 (Gene Name=PALS1)

[Back to BioLiP]