Structure of PDB 7qbc Chain B Binding Site BS01

Receptor Information
>7qbc Chain B (length=298) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIM
FGVRCGAAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLS
NYSSVTYALTGFPQFISRGDVHVYGATNIIQVLLVASIETSLVFQIKVIF
TGDNFKRIGLMLTSISFTLGIATVTMYFVSAVKGMIVTYNDVSATQDKYF
NASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQFDSFHILLIMSCQS
LLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAANNA
Ligand information
>7qbc Chain K (length=13) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WHWLQLKPGQPMY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qbc Activation mechanism of the class D fungal GPCR dimer Ste2.
Resolution3.53 Å
Binding residue
(original residue number in PDB)		Q51 H94 Y98 Y101 Y128 T131 N132 Q135 Y181 S184 A185 K202 F204 N205 I263 Y266 S267 K269 P270 N271 D275
Binding residue
(residue number reindexed from 1)		Q47 H90 Y94 Y97 Y124 T127 N128 Q131 Y177 S180 A181 K198 F200 N201 I259 Y262 S263 K265 P266 N267 D271
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004932 mating-type factor pheromone receptor activity
GO:0004934 mating-type alpha-factor pheromone receptor activity
GO:0005515 protein binding
Biological Process
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0000755 cytogamy
GO:0007186 G protein-coupled receptor signaling pathway
GO:0019236 response to pheromone
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0038038 G protein-coupled receptor homodimeric complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qbc, PDBe:7qbc, PDBj:7qbc
PDBsum7qbc
PubMed35296853
UniProtD6VTK4|STE2_YEAST Pheromone alpha factor receptor (Gene Name=STE2)

[Back to BioLiP]