Structure of PDB 7qa8 Chain B Binding Site BS01

Receptor Information
>7qa8 Chain B (length=299) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIM
FGVRCGAAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLS
NYSSVTYALTGFPQFISRGDVHVYGATNIIQVLLVASIETSLVFQIKVIF
TGDNFKRIGLMLTSISFTLGIATVTMYFVSAVKGMIVTYNDVSATQDKYF
NASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQFDSFHILLIMSCQS
LLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAANNAS
Ligand information
>7qa8 Chain K (length=12) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HALQLKPGQPKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qa8 Activation mechanism of the class D fungal GPCR dimer Ste2.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H94 Y98 Y101 Y106 Y128 T131 N132 S184 A185 T199 D201 F204 N205 T274 D275
Binding residue
(residue number reindexed from 1)		H90 Y94 Y97 Y102 Y124 T127 N128 S180 A181 T195 D197 F200 N201 T270 D271
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004932 mating-type factor pheromone receptor activity
GO:0004934 mating-type alpha-factor pheromone receptor activity
GO:0005515 protein binding
Biological Process
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0000755 cytogamy
GO:0007186 G protein-coupled receptor signaling pathway
GO:0019236 response to pheromone
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0038038 G protein-coupled receptor homodimeric complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qa8, PDBe:7qa8, PDBj:7qa8
PDBsum7qa8
PubMed35296853
UniProtD6VTK4|STE2_YEAST Pheromone alpha factor receptor (Gene Name=STE2)

[Back to BioLiP]