Structure of PDB 7q8a Chain B Binding Site BS01

Receptor Information

>7q8a Chain B (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSW
DSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQ
PIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPT
TGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPL

Ligand information

>7q8a Chain D (length=2) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q8a Crystal structure of tandem domain RRM1-2 of FIR bound to FUSE ssDNA fragment
Resolution	2.05 Å
Binding residue (original residue number in PDB)	Y115 S118 K153 G154 F157 P188 S189
Binding residue (residue number reindexed from 1)	Y20 S23 K58 G59 F62 P93 S94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7q8a, PDBe:7q8a, PDBj:7q8a
PDBsum	7q8a
PubMed
UniProt	Q9UHX1\|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 (Gene Name=PUF60)

[Back to BioLiP]