Structure of PDB 7q4q Chain B Binding Site BS01

Receptor Information
>7q4q Chain B (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSGYWMNWVRQAPGQGLEWIGQ
IYPGDGDTNYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARSI
TTVVLDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYT
CNVDHKPSNTKVDKRVESK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4q Structural basis of human LRG1 recognition by Magacizumab, a humanized monoclonal antibody with therapeutic potential.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		G31 W33 Q50 Y52 D55 D57 T101 V103
Binding residue
(residue number reindexed from 1)		G31 W33 Q50 Y52 D55 D57 T101 V103
External links