Structure of PDB 7pza Chain B Binding Site BS01

Receptor Information

>7pza Chain B (length=226) Species: 266834 (Sinorhizobium meliloti 1021) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RSSAFWRSFPIFEEFDSETLCELSGIASYRKWSAGTVIFQRGDQGDYMIV
VVSGRIKLSLFTPQGRELMLRQHEAGALFGEMALLDGQPRSADATAVTAA
EGYVIGKKDFLALITQRPKTAEAVIRFLCAQLRDTTDRLETIALYDLNAR
VARFFLATLRQIHGSEMPQSANLRLTLSQTDIASILGASRPKVNRAILSL
EESGAIKRADGIICCNVGRLLSIADP

Ligand information

>7pza Chain E (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctaggtaacatta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pza Structural Basis of Dual Specificity of Sinorhizobium meliloti Clr, a cAMP and cGMP Receptor Protein.
Resolution	2.72 Å
Binding residue (original residue number in PDB)	D151 L152 A193 S194 K197
Binding residue (residue number reindexed from 1)	D146 L147 A188 S189 K192

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pza, PDBe:7pza, PDBj:7pza
PDBsum	7pza
PubMed	37017526
UniProt	Q92SD2

[Back to BioLiP]