Structure of PDB 7pkq Chain B Binding Site BS01

Receptor Information
>7pkq Chain B (length=53) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AARAAANAAAYPVDVEHSFCRRTRTAALSTARYGSREANRKLLLEHYNEL
LRA
Ligand information
>7pkq Chain u (length=24) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKGDNRTRRGKIFRGTYREQLPSH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pkq The Chlamydomonas mitochondrial ribosome: how to build a ribosome from RNA fragments
Resolution4.2 Å
Binding residue
(original residue number in PDB)		A818 A819 N824
Binding residue
(residue number reindexed from 1)		A1 A2 N7
Enzymatic activity
Enzyme Commision number ?
External links