Structure of PDB 7pdt Chain B Binding Site BS01

Receptor Information
>7pdt Chain B (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DMPVEKILEAELANDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQV
ILLRAGWNELLAASASHRSIAVKDGILLTTGLHVHRNSAHSAGVGAIFDR
VLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYA
SLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPID
TFLMEMLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pdt Design and in vitro characterization of RXR variants as tools to investigate the biological role of endogenous rexinoids.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		F282 V303 R307 F455 E458
Binding residue
(residue number reindexed from 1)		F29 V50 R54 F202 E205
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pdt, PDBe:7pdt, PDBj:7pdt
PDBsum7pdt
PubMed35900852
UniProtP28700|RXRA_MOUSE Retinoic acid receptor RXR-alpha (Gene Name=Rxra)

[Back to BioLiP]