Structure of PDB 7pc7 Chain B Binding Site BS01

Receptor Information
>7pc7 Chain B (length=404) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GERTVTIRRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGD
AILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLSAYGSVKAYTNFDA
ERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELAS
ALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSR
TNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSV
IDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSY
SPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRD
KVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLC
GGDD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pc7 A scalable strategy to solve structures of PDZ domains and their complexes.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		G67 G69 L70 S71 I72 K73 K86 H118 V122
Binding residue
(residue number reindexed from 1)		G14 G16 L17 S18 I19 K20 K33 H65 V69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0002020 protease binding
GO:0003723 RNA binding
GO:0004859 phospholipase inhibitor activity
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005544 calcium-dependent phospholipid binding
GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
GO:0008092 cytoskeletal protein binding
GO:0019834 phospholipase A2 inhibitor activity
GO:0042802 identical protein binding
GO:0044548 S100 protein binding
GO:0048306 calcium-dependent protein binding
GO:0098641 cadherin binding involved in cell-cell adhesion
Biological Process
GO:0001525 angiogenesis
GO:0001765 membrane raft assembly
GO:0001921 positive regulation of receptor recycling
GO:0002091 negative regulation of receptor internalization
GO:0006900 vesicle budding from membrane
GO:0007155 cell adhesion
GO:0007160 cell-matrix adhesion
GO:0010756 positive regulation of plasminogen activation
GO:0014823 response to activity
GO:0030199 collagen fibril organization
GO:0030324 lung development
GO:0031340 positive regulation of vesicle fusion
GO:0032804 negative regulation of low-density lipoprotein particle receptor catabolic process
GO:0036035 osteoclast development
GO:0042730 fibrinolysis
GO:0042789 mRNA transcription by RNA polymerase II
GO:0044090 positive regulation of vacuole organization
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0098609 cell-cell adhesion
GO:1904019 epithelial cell apoptotic process
GO:1905581 positive regulation of low-density lipoprotein particle clearance
GO:1905597 positive regulation of low-density lipoprotein particle receptor binding
GO:1905599 positive regulation of low-density lipoprotein receptor activity
GO:1905602 positive regulation of receptor-mediated endocytosis involved in cholesterol transport
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0001533 cornified envelope
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005769 early endosome
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005912 adherens junction
GO:0009986 cell surface
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016363 nuclear matrix
GO:0030496 midbody
GO:0031902 late endosome membrane
GO:0031982 vesicle
GO:0035578 azurophil granule lumen
GO:0035749 myelin sheath adaxonal region
GO:0042383 sarcolemma
GO:0042470 melanosome
GO:0043220 Schmidt-Lanterman incisure
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex
GO:1990667 PCSK9-AnxA2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pc7, PDBe:7pc7, PDBj:7pc7
PDBsum7pc7
PubMed35362473
UniProtP07355|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2);
Q9NSN8

[Back to BioLiP]