Structure of PDB 7p71 Chain B Binding Site BS01

Receptor Information

>7p71 Chain B (length=420) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAA
LDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPL
GSSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQ
DIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMK
GLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK
LMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTE
RSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLY
FADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYI
QQDTKGDYQKALLYLCGGDD

Ligand information

>7p71 Chain D (length=4) Species: 10587 (human papillomavirus 35) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ETEV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7p71 Quantitative fragmentomics allow affinity mapping of interactomes.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	G481 F482 G483 F484 T485 V486 K499 H532 F539
Binding residue (residue number reindexed from 1)	G23 F24 G25 F26 T27 V28 K41 H74 F81

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001786	phosphatidylserine binding
GO:0002020	protease binding
GO:0003723	RNA binding
GO:0004859	phospholipase inhibitor activity
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005544	calcium-dependent phospholipid binding
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
GO:0008092	cytoskeletal protein binding
GO:0019834	phospholipase A2 inhibitor activity
GO:0042802	identical protein binding
GO:0044548	S100 protein binding
GO:0048306	calcium-dependent protein binding
GO:0098641	cadherin binding involved in cell-cell adhesion

	Biological Process
GO:0001525	angiogenesis
GO:0001765	membrane raft assembly
GO:0001921	positive regulation of receptor recycling
GO:0002091	negative regulation of receptor internalization
GO:0006900	vesicle budding from membrane
GO:0007155	cell adhesion
GO:0007160	cell-matrix adhesion
GO:0010756	positive regulation of plasminogen activation
GO:0014823	response to activity
GO:0030199	collagen fibril organization
GO:0030324	lung development
GO:0031340	positive regulation of vesicle fusion
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process
GO:0036035	osteoclast development
GO:0042730	fibrinolysis
GO:0042789	mRNA transcription by RNA polymerase II
GO:0044090	positive regulation of vacuole organization
GO:0045921	positive regulation of exocytosis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050767	regulation of neurogenesis
GO:0098609	cell-cell adhesion
GO:1904019	epithelial cell apoptotic process
GO:1905581	positive regulation of low-density lipoprotein particle clearance
GO:1905597	positive regulation of low-density lipoprotein particle receptor binding
GO:1905599	positive regulation of low-density lipoprotein receptor activity
GO:1905602	positive regulation of receptor-mediated endocytosis involved in cholesterol transport
GO:1905686	positive regulation of plasma membrane repair

	Cellular Component
GO:0001533	cornified envelope
GO:0005576	extracellular region
GO:0005604	basement membrane
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005769	early endosome
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005912	adherens junction
GO:0009986	cell surface
GO:0012506	vesicle membrane
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016363	nuclear matrix
GO:0030496	midbody
GO:0031902	late endosome membrane
GO:0031982	vesicle
GO:0035578	azurophil granule lumen
GO:0035749	myelin sheath adaxonal region
GO:0042383	sarcolemma
GO:0042470	melanosome
GO:0043220	Schmidt-Lanterman incisure
GO:0045121	membrane raft
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0090575	RNA polymerase II transcription regulator complex
GO:0098797	plasma membrane protein complex
GO:1990665	AnxA2-p11 complex
GO:1990667	PCSK9-AnxA2 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7p71, PDBe:7p71, PDBj:7p71
PDBsum	7p71
PubMed	36115835
UniProt	P07355\|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2); Q96QZ7\|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (Gene Name=MAGI1)

[Back to BioLiP]