Structure of PDB 7p33 Chain B Binding Site BS01

Receptor Information
>7p33 Chain B (length=155) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYSTREILLALCIRDSRVHGNGTLHPVLELAAREPLRLSPEDTVVLRYHV
LLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRAL
AWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWST
LIEDN
Ligand information
>7p33 Chain F (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEDIIRNIARHLAQVGDSMD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p33 Crystal Structures of Epstein-Barr Virus Bcl-2 Homolog BHRF1 Bound to Bid and Puma BH3 Motif Peptides.
Resolution2.78543 Å
Binding residue
(original residue number in PDB)		I57 N61 F72 H75 S85 V86 E89 I90 G99 R100 W107
Binding residue
(residue number reindexed from 1)		I55 N59 F70 H73 S83 V84 E87 I88 G97 R98 W105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7p33, PDBe:7p33, PDBj:7p33
PDBsum7p33
PubMed36298777
UniProtP03182|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]