Structure of PDB 7p0u Chain B Binding Site BS01

Receptor Information
>7p0u Chain B (length=132) Species: 10258 (Orf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQEL
SNAEHPENSHIPAALVSALLEPTSPGRMVTAVELCAQMGRLWTRGRQLVD
FMRLVYVLLDRLPPTADEDLGAWLQAVARVHG
Ligand information
>7p0u Chain U (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSSAAQLTAARLKALGDELHQRTMWR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0u Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk.
Resolution1.99374 Å
Binding residue
(original residue number in PDB)		E45 R48 L52
Binding residue
(residue number reindexed from 1)		E40 R43 L47
Enzymatic activity
Enzyme Commision number ?
External links