Structure of PDB 7p0s Chain B Binding Site BS01

Receptor Information
>7p0s Chain B (length=132) Species: 10258 (Orf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQE
LSNAGEHNSHIPAALVSALLEPTSPGRMVTAVELCAQMGRLWTRGRQLVD
FMRLVYVLLDRLPPTADEDLGAWLQAVARVHG
Ligand information
>7p0s Chain C (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WAREIGAQLRRMADDLNAQYERR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0s Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk.
Resolution2.50316 Å
Binding residue
(original residue number in PDB)		E46 V47 P50 L51 E54 I70 P85 G86 R87 T90 W133 A136 V137 V140
Binding residue
(residue number reindexed from 1)		E42 V43 P46 L47 E50 I61 P75 G76 R77 T80 W123 A126 V127 V130
Enzymatic activity
Enzyme Commision number ?
External links