Structure of PDB 7p0l Chain B Binding Site BS01

Receptor Information
>7p0l Chain B (length=195) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNLVTSSFNLTKPMKSFIRRNGLRVQESVTDETDFVILGSPPLRRTHKFL
LATSLGIPLVSSQYLTDCIKSGKVLDFRSYKYKDEEAEAKWGFRLDDIHR
RTCFNGKRLYITKAIRDSMVGDSIHGLYSILETSGAEIVGDIKRAQEKDT
IILAQPDNDQEGRNMSATGLNVYKIELVALSILRDRIDFDEFLID
Ligand information
>7p0l Chain D (length=5) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSQEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0l Phosphorylation-dependent assembly of DNA damage response systems and the central roles of TOPBP1.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		S392 S393 R430 R431 T432 K434 W477 L513
Binding residue
(residue number reindexed from 1)		S6 S7 R44 R45 T46 K48 W91 L127
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7p0l, PDBe:7p0l, PDBj:7p0l
PDBsum7p0l
PubMed34678589
UniProtO14079|MDB1_SCHPO DNA damage response protein Mdb1 (Gene Name=mdb1)

[Back to BioLiP]