Structure of PDB 7olg Chain B Binding Site BS01

Receptor Information
>7olg Chain B (length=70) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7olg EB1 bound to MACF peptide
ResolutionN/A
Binding residue
(original residue number in PDB)		L205 D209 E213
Binding residue
(residue number reindexed from 1)		L15 D19 E23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008017 microtubule binding

View graph for
Molecular Function
External links
PDB RCSB:7olg, PDBe:7olg, PDBj:7olg
PDBsum7olg
PubMed
UniProtQ61166|MARE1_MOUSE Microtubule-associated protein RP/EB family member 1 (Gene Name=Mapre1)

[Back to BioLiP]