Structure of PDB 7oa6 Chain B Binding Site BS01

Receptor Information
>7oa6 Chain B (length=152) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPG
VKSKKDIDIEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVI
TLPDYPGVDADNIKADYANGVLTLTVPKLKPQKDGKNHVKKIEVSSQESW
GN
Ligand information
>7oa6 Chain X (length=14) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKKIEVSSQESWGN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oa6 Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		E210 S211 W212 N214
Binding residue
(residue number reindexed from 1)		E148 S149 W150 N152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0042802 identical protein binding
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0034605 cellular response to heat
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oa6, PDBe:7oa6, PDBj:7oa6
PDBsum7oa6
PubMed34795272
UniProtP15992|HSP26_YEAST Heat shock protein 26 (Gene Name=HSP26)

[Back to BioLiP]