Structure of PDB 7o6n Chain B Binding Site BS01

Receptor Information
>7o6n Chain B (length=97) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSSHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSKKSAAPVT
YDVSQVYEFLDKLSDVSMMIFNRETGQYIGRTRAWIKQQVYEMMRGR
Ligand information
>7o6n Chain C (length=17) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FNSEDIKDSVFKVLHAE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o6n Structural basis of PETISCO complex assembly during piRNA biogenesis in C. elegans .
Resolution2.17 Å
Binding residue
(original residue number in PDB)		T21 W22 K37 M38 D41 F42 K45 F61
Binding residue
(residue number reindexed from 1)		T19 W20 K35 M36 D39 F40 K43 F59
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7o6n, PDBe:7o6n, PDBj:7o6n
PDBsum7o6n
PubMed34413138
UniProtQ20057|ERH2_CAEEL Enhancer of rudimentary homolog 2 (Gene Name=erh-2)

[Back to BioLiP]