Structure of PDB 7o56 Chain B Binding Site BS01

Receptor Information
>7o56 Chain B (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALF
KAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDP
YKVYRIVPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o56 Phosphorus and sulfur SAD phasing of the nucleic acid-bound DNA-binding domain of interferon regulatory factor 4.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		W54 H56 A57 K94 R98 K103
Binding residue
(residue number reindexed from 1)		W33 H35 A36 K73 R77 K82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7o56, PDBe:7o56, PDBj:7o56
PDBsum7o56
PubMed34196610
UniProtQ15306|IRF4_HUMAN Interferon regulatory factor 4 (Gene Name=IRF4)

[Back to BioLiP]