Structure of PDB 7nx5 Chain B Binding Site BS01

Receptor Information

>7nx5 Chain B (length=61) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSL
DVDSIIPRTPD

Ligand information

>7nx5 Chain C (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cttcatcgctcagtgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7nx5 Structural basis of DNA methylation-dependent site selectivity of the Epstein-Barr virus lytic switch protein ZEBRA/Zta/BZLF1.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	R179 N182 R183 S186 R187 R190 K194
Binding residue (residue number reindexed from 1)	R4 N7 R8 S11 R12 R15 K19

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7nx5, PDBe:7nx5, PDBj:7nx5
PDBsum	7nx5
PubMed	34893887
UniProt	P03206\|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]