Structure of PDB 7nkd Chain B Binding Site BS01

Receptor Information

>7nkd Chain B (length=47) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

TISAADIEGAIEDYVSSFEIGTVIDAAHVEGLPSVLDEHSVGEEGQQ

Ligand information

>7nkd Chain F (length=17) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

RVVRVEFPRGDSLVRGV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nkd Structure of the ATP synthase from Mycobacterium smegmatis provides targets for treating tuberculosis.
• Resolution: 3.12 Å
• Binding residue (original residue number in PDB): L47 L69 D70 E71 V74
• Binding residue (residue number reindexed from 1): L32 L36 D37 E38 V41

Enzymatic activity

• Enzyme Commision number: 7.1.2.2: H(+)-transporting two-sector ATPase.

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0032559 adenyl ribonucleotide binding
• GO:0043531 ADP binding
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
• GO:0046961 proton-transporting ATPase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:0046034 ATP metabolic process
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0045259 proton-transporting ATP synthase complex
• GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

External links

• PDB: RCSB:7nkd, PDBe:7nkd, PDBj:7nkd
• PDBsum: 7nkd
• PubMed: 34782468
• UniProt: A0R202|ATPA_MYCS2 ATP synthase subunit alpha (Gene Name=atpA)