Structure of PDB 7n19 Chain B Binding Site BS01

Receptor Information
>7n19 Chain B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTEL
GRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYP
SKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDW
TFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n19 CD4+ T cells in the lungs of acute sarcoidosis patients recognize an Aspergillus nidulans epitope.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		E9 S11 S13 Y26 Y30 N37 D57 Y60 W61 L67 Q70 K71 R74 Y78 H81 N82 V86
Binding residue
(residue number reindexed from 1)		E6 S8 S10 Y23 Y27 N34 D54 Y57 W58 L64 Q67 K68 R71 Y75 H78 N79 V83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7n19, PDBe:7n19, PDBj:7n19
PDBsum7n19
PubMed34410304
UniProtQ5Y7D1

[Back to BioLiP]