Structure of PDB 7mwl Chain B Binding Site BS01

Receptor Information
>7mwl Chain B (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIK
YLSRNVVHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRI
QAITG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mwl The TAM domain of BAZ2A in complex with a 12mer mCG DNA
Resolution1.84 Å
Binding residue
(original residue number in PDB)		K588 Q589
Binding residue
(residue number reindexed from 1)		K43 Q44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7mwl, PDBe:7mwl, PDBj:7mwl
PDBsum7mwl
PubMed
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]