Structure of PDB 7mwk Chain B Binding Site BS01

Receptor Information
>7mwk Chain B (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFKSKPQLARYL
GNTVDLSSFDFRTGKMMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mwk Crystal structure of MBD2 with DNA
Resolution2.453 Å
Binding residue
(original residue number in PDB)		K188 S189 K190 R209
Binding residue
(residue number reindexed from 1)		K41 S42 K43 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7mwk, PDBe:7mwk, PDBj:7mwk
PDBsum7mwk
PubMed
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]