Structure of PDB 7mtl Chain B Binding Site BS01

Receptor Information

>7mtl Chain B (length=162) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AVPSSKEELIKAINSNFSLLNKKLESITPQLAFEPLLTTISVANLVSYLI
GWGELVLHWHDQEAKGKTIIFPEEGFKWNELGRLAQKFYRDYEDITEYEV
LLARLKENKQQLVALIERFSNDELYGKPWYNKWTRGRMIQFNTASPYKNA
SGRLNKLQKCLA

Ligand information

>7mtl Chain D (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctggaagtgggaatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7mtl Structural Basis for the Interactions of the Colibactin Resistance Gene Product ClbS with DNA.
Resolution	2.446 Å
Binding residue (original residue number in PDB)	A2 V3 W85 L88 W140 R144 M145 F148 N149
Binding residue (residue number reindexed from 1)	A1 V2 W78 L81 W133 R137 M138 F141 N142

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:7mtl, PDBe:7mtl, PDBj:7mtl
PDBsum	7mtl
PubMed	33945270
UniProt	Q0P7K8

[Back to BioLiP]