Structure of PDB 7mpu Chain B Binding Site BS01

Receptor Information

>7mpu Chain B (length=206) Species: 29459 (Brucella melitensis)

SMTIRFHRNDLPNLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPGDGTA
DVIQIEAGQKKAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVF
CTKIASKLTRTYTDRHGLKEICSELLDVSISKQQQSSDWAAEVLSQAQLE
YAASDVLYLHRLKAVLEQRLERDGRTKQAEACFKFLPTRSELDLMGWAES
DIFAHS

Ligand information

>7mpu Chain D (length=2)

gg

..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7mpu Structural characterization of NrnC identifies unifying features of dinucleotidases.
• Resolution: 1.72 Å
• Binding residue (original residue number in PDB): T25 E26 T27 G29 L30 H78 F82 K102 G116 Q134 W138
• Binding residue (residue number reindexed from 1): T26 E27 T28 G30 L31 H79 F83 K103 G117 Q135 W139

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 16:04:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7mpu', asym_id = 'B', bs = 'BS01', title = 'Structural characterization of NrnC identifies unifying features of dinucleotidases.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7mpu', asym_id='B', bs='BS01', title='Structural characterization of NrnC identifies unifying features of dinucleotidases.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003676,0006139,0008408', uniprot = '', pdbid = '7mpu', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0006139,0008408', uniprot='', pdbid='7mpu', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>