Structure of PDB 7mey Chain B Binding Site BS01

Receptor Information
>7mey Chain B (length=153) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGT
FRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
ASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDD
MDD
Ligand information
Ligand IDZ3V
InChIInChI=1S/C4H11NS/c1-2-5-3-4-6/h5-6H,2-4H2,1H3
InChIKeyKMTRYVQPHVFAFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 12.01
CACTVS 3.385
OpenEye OEToolkits 2.0.7		CCNCCS
FormulaC4 H11 N S
Name2-(ethylamino)ethane-1-thiol
ChEMBL
DrugBank
ZINC
PDB chain7mey Chain D Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mey Structural insights into Ubr1-mediated N-degron polyubiquitination.
Resolution3.67 Å
Binding residue
(original residue number in PDB)		C88 S120 P121
Binding residue
(residue number reindexed from 1)		C86 S118 P119
Annotation score1
Enzymatic activity
Enzyme Commision number 2.3.2.23: E2 ubiquitin-conjugating enzyme.
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016740 transferase activity
GO:0017116 single-stranded DNA helicase activity
GO:0061631 ubiquitin conjugating enzyme activity
GO:0070628 proteasome binding
Biological Process
GO:0000209 protein polyubiquitination
GO:0000722 telomere maintenance via recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006353 DNA-templated transcription termination
GO:0006366 transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0009302 sno(s)RNA transcription
GO:0016567 protein ubiquitination
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0031509 subtelomeric heterochromatin formation
GO:0031571 mitotic G1 DNA damage checkpoint signaling
GO:0032508 DNA duplex unwinding
GO:0034620 cellular response to unfolded protein
GO:0036503 ERAD pathway
GO:0042138 meiotic DNA double-strand break formation
GO:0042275 error-free postreplication DNA repair
GO:0042276 error-prone translesion synthesis
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070987 error-free translesion synthesis
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway
GO:0071629 cytoplasm protein quality control by the ubiquitin-proteasome system
GO:0090089 regulation of dipeptide transport
GO:0120174 stress-induced homeostatically regulated protein degradation pathway
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0033503 HULC complex
GO:0097505 Rad6-Rad18 complex
GO:1990303 UBR1-RAD6 ubiquitin ligase complex
GO:1990304 MUB1-RAD6-UBR2 ubiquitin ligase complex
GO:1990305 RAD6-UBR2 ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mey, PDBe:7mey, PDBj:7mey
PDBsum7mey
PubMed34789879
UniProtP06104|UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 (Gene Name=RAD6)

[Back to BioLiP]