Structure of PDB 7lo0 Chain B Binding Site BS01

Receptor Information

>7lo0 Chain B (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE
EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTY
RGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHI
NWE

Ligand information

>7lo0 Chain J (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DPRRQELLEARFTGV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7lo0 Tousled-like kinase 2 targets ASF1 histone chaperones through client mimicry.
Resolution	2.71 Å
Binding residue (original residue number in PDB)	A48 E49 E51 D54 D88 V94 R108 G110 Y111 Y112 R145
Binding residue (residue number reindexed from 1)	A47 E48 E50 D53 D87 V93 R107 G109 Y110 Y111 R144

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7lo0, PDBe:7lo0, PDBj:7lo0
PDBsum	7lo0
PubMed	35136069
UniProt	Q9Y294\|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]